Exendin-4 acetate
Cat. No. :YN1720013
CAS No. :914454-01-6
86-020-82000279
sales@ubiochem.com
order@ubiochem.com| Product Name: | Exendin-4 acetate |
| CAS NO.: | 914454-01-6 |
| Chemical Name: | |
| Synonyms: | |
| Molecular Weight: | 4246.62 |
| Molecular Formula: | C₁₈₆H₂₈₆N₅₀O₆₂S |
| SMILES: | CC(O)=O.[HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2] |
| Storage: | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Transportation: | Room temperature in continental US; may vary elsewhere. |
| Description: | Exendin-4 acetate (Exenatide acetate), a 39 amino acid peptide, is a long-actingglucagon-likepeptide-1 receptor agonist with an IC50 of 3.22nM. |
| IC50&Target: | |
| In Vitro: | |
| In Vivo: | |
| Clinical Trial: | |
| Solvent & Solubility: | |
| References: |
TELL : +86-020-82000279
Add:Room 519, Block F, Guangzhou International Business Incubator, No.3 Lanyue Road, Science Town, Huangpu District, Guangzhou, China.
