Gastric Inhibitory Peptide (GIP), human
Cat. No. :YN483788
CAS No. :100040-31-1
86-020-82000279
sales@ubiochem.com
order@ubiochem.com| Product Name: | Gastric Inhibitory Peptide (GIP), human |
| CAS NO.: | 100040-31-1 |
| Chemical Name: | |
| Synonyms: | |
| Molecular Weight: | 4983.60 |
| Molecular Formula: | C₂₂₆H₃₃₈N₆₀O₆₆S |
| SMILES: | [YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ] |
| Storage: | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Transportation: | Room temperature in continental US; may vary elsewhere. |
| Description: | Gastric Inhibitory Peptide (GIP), human is thought to act as an inhibitor of gastric functions. |
| IC50&Target: | |
| In Vitro: | |
| In Vivo: | |
| Clinical Trial: | |
| Solvent & Solubility: | |
| References: |
TELL : +86-020-82000279
Add:Room 519, Block F, Guangzhou International Business Incubator, No.3 Lanyue Road, Science Town, Huangpu District, Guangzhou, China.
