β-Endorphin, human
Cat. No. :YN321948
CAS No. :61214-51-5
86-020-82000279
sales@ubiochem.com
order@ubiochem.com| Product Name: | β-Endorphin, human |
| CAS NO.: | 61214-51-5 |
| Chemical Name: | |
| Synonyms: | |
| Molecular Weight: | 3464.98 |
| Molecular Formula: | C₁₅₈H₂₅₁N₃₉O₄₆S |
| SMILES: | [YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE] |
| Storage: | Please store the product under the recommended conditions in the Certificate of Analysis. |
| Transportation: | Room temperature in continental US; may vary elsewhere. |
| Description: | β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist ofopioid receptor, with preferred affinity forμ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity. |
| IC50&Target: | |
| In Vitro: | |
| In Vivo: | |
| Clinical Trial: | |
| Solvent & Solubility: | |
| References: |
TELL : +86-020-82000279
Add:Room 519, Block F, Guangzhou International Business Incubator, No.3 Lanyue Road, Science Town, Huangpu District, Guangzhou, China.
